About | Contact | SUBMIT PRESS | Advertise | FAQ
Newsletters | Twitter |
HomeNewsArticlesExpertsDataJobsEDULBSEVENTSDIRBLOGSocial MediaNEW! GeoJobs
Software | Spotlights on Geospatial Data | Webmaps and Web Services | Mashup Zone | IMAGING | Hardware | Social Media  
advertisement

HOT News


CycloMedia Launches Driving Dutchman Tour to Acquire Large-Scale Professional Images Throughout USA

Top Geo News
Put Your News here! 

Visual Intelligence Partners with Pix4D for Aerial Imaging Innovation
Rapidly Making Colorful Landsat-8 Imagery Composite with Free Advanced Image Stretching and Pan-sharpening Software from GeoSage - See more at: http://www.gisuser.com/content/view/30197/2/#sthash.36sxzlnJ.dpuf

Got news? Send to
submit press to GISuser

Social Connect




vimeostumble


GISuser Sponsor


GISuser Videos


See also SpatialVideos Youtube

Recent Site Additions
Webinars
GIS Job Opportunities
 

More at GeoJobs.BIZ!

Department Information System Analyst II (GIS Analyst)
2D/3D GIS Mapping Product Engineer
GIS Technician
Technical Advisor
Graphics Technician (GIS Technician)
Senior Survey Technician – Specialist
Senior GIS Analyst
Research Analyst in Geospatial Analytics
GIS Specialist III
Implementation Specialist
GISuser Sponsor

GISuser Sponsor


feed

AnyGeo - Anything Geospatial

↑ Grab this Headline Animator

GISuser Feed

Hot Job

hot gis tech job
GIS Analyst, Pasadena CA

Home arrow Articles arrow Data arrow GISuser Guide to downloading Free NWI and USFWS data products     

HOT JOB
post a GIS job * JOBS * GIS Analyst, Pasadena CA / Graphics Technician, Vancouver BC 
See the new GeoJobs.BIZ
Submit News/tips to press @gisuser.com
GISuser Guide to downloading Free NWI and USFWS data products E-mail
Written by Glenn Letham   
26 February 2004
The US Fish and Wildlife service makes a number of digital spatial data products available to the public for free download. The data sets accessible for each State are for larger scale data (1:24:000 up to 1:500,000). Most of these datasets are provided as ArcView SHP or E00 coverages.

By clicking on a State, you will then be presented with a number of available dataporducts including; data created by or maintained by the U.S. Fish and Wildlife Service as well as links to the metadata and data where possible. Data from other agencies is shown provided. NWI data downloads are provided in Arc/Info export or DLG formats and arranged by 1:250,000 quads.

To access and download 1:100K USGS DLG data, please select a State on the map below.

WAORIDMTNDMNCANVUTAZWYCONMSDIANEKSWIMIILMOOKTXARLAINOHKYTNMSALGAFLSCNCVADCWVPAMDDENJRIMACTVTMENHNYVIPRHIAK

Note: The image used to create this map was provided by the .

For a diagram that easily explains the NWI map codes, please see the reference diagrom provided below.


                    WETLANDS AND DEEPWATER HABITATS CLASSIFICATION


SYSTEM              SUBSYSTEM        CLASS                     SUBCLASS

                                  |- RB=Rock Bottom            1=Bedrock
                                  |                            2=Rubble
                                  |
                                  |- UB=Unconsolidated Bottom  1=Cobble-Gravel
                                  |                            2=Sand
                                  |                            3=Mud
                                  |                            4=Organic
                                  |
                |-- 1=SUBTIDAL----|- AB=Aquatic Bed            1=Algal
                |                 |                            3=Rooted Vascular
                |                 |                            5=Unknown 
                |                 |                              Submergent
                |                 |
                |                 |- RF=Reef                   1=Coral
                |                 |                            3=Worm
                |                 |
                |                 |- OW=Open Water/Unknown Bottom (used on older
                |                                                  maps)
M=MARINE--------|
                |
                |
                |                 |- AB=Aquatic Bed            1=Algal
                |                 |                            3=Rooted Vascular
                |                 |                            5=Unknown 
                |                 |                              Submergent
                |                 |
                |                 |- RF=Reef                   1=Coral
                |-- 2=INTERTIDAL--|                            3=Worm
                                  |
                                  |- RS=Rocky Shore            1=Bedrock
                                  |                            2=Rubble
                                  |
                                  |- US=Unconsolidated Shore   1=Cobble-Gravel
                                                               2=Sand
                                                               3=Mud
                                                               4=Organic

 

SYSTEM              SUBSYSTEM        CLASS                     SUBCLASS

                                  |- RB=Rock Bottom            1=Bedrock
                                  |                            2=Rubble
                                  |
                                  |- UB=Unconsolidated Bottom  1=Cobble-Gravel
                                  |                            2=Sand
                                  |                            3=Mud
                                  |                            4=Organic
                                  |
                |-- 1=SUBTIDAL----|- AB=Aquatic Bed            1=Algal
                |                 |                            3=Rooted Vascular
                |                 |                            4=Floating 
                |                 |                              Vascular
                |                 |                            5=Unknown 
                |                 |                              Submergent
                |                 |                            6=Unknown Surface
                |                 |
                |                 |- RF=Reef                   2=Mollusc
                |                 |                            3=Worm
                |                 |
                |                 |- OW=Open Water/Unknown Bottom (used on older
                |                                                  maps)
E=ESTUARINE-----|
                |                  
                |
                |                 |- AB=Aquatic Bed            1=Algal
                |                 |                            3=Rooted Vascular
                |                 |                            4=Floating 
                |                 |                              Vascular
                |                 |                            5=Unknown 
                |                 |                              Submergent
                |                 |                            6=Unknown Surface
                |                 |
                |                 |- RF=Reef                   2=Mollusc
                |                 |                            3=Worm
                |                 |
                |                 |- SB=Streambed              3=Cobble-Gravel
                |                 |                            4=Sand
                |                 |                            5=Mud
                |                 |                            6=Organic
                |                 |
                |                 |- RS=Rocky Shore            1=Bedrock
                |                 |                            2=Rubble
                |                 |
                |-- 2=INTERTIDAL--|- US=Unconsolidated Shore   1=Cobble-Gravel
                                  |                            2=Sand
                                  |                            3=Mud
                                  |                            4=Organic
                                  |
                                  |- EM=Emergent               1=Persistent
                                  |                            2=Nonpersistent
                                  |
                                  |- SS=Scrub-Shrub            1=Broad-Leaved
                                  |                              Deciduous
                                  |                            2=Needle-Leaved
                                  |                              Deciduous
                                  |                            3=Broad-Leaved 
                                  |                              Evergreen
                                  |                            4=Needle-Leaved
                                  |                              Evergreen
                                  |                            5=Dead
                                  |                            6=Indeterminate
                                  |                              Deciduous
                                  |                            7=Indeterminate
                                  |                              Evergreen
                                  |
                                  |- FO=Forested               1=Broad-Leaved
                                                                 Deciduous
                                                               2=Needle-Leaved
                                                                 Deciduous
                                                               3=Broad-Leaved
                                                                 Evergreen
                                                               4=Needle-Leaved
                                                                 Evergreen
                                                               5=Dead
                                                               6=Indeterminate
                                                                 Deciduous
                                                               7=Indeterminate
                                                                 Evergreen



 
SYSTEM              SUBSYSTEM        CLASS                     SUBCLASS

                                  |- RB=Rock Bottom            1=Bedrock
                                  |                            2=Rubble
                                  |
                                  |- UB=Unconsolidated Bottom  1=Cobble-Gravel
                                  |                            2=Sand
                |--1=TIDAL--------|                            3=Mud
                |                 |                            4=Organic
                |                 |
                |                 |-*SB=Streambed              1=Bedrock
                |                 |                            2=Rubble
                |                 |                            3=Cobble-Gravel
                |--2=LOWER        |                            4=Sand
                |    PERENNIAL----|                            5=Mud
                |                 |                            6=Organic
                |                 |                            7=Vegetated
                |                 |
                |                 |- AB=Aquatic Bed            1=Algal
R=RIVERINE------|--3=UPPER        |                            2=Aquatic Moss
                |    PERENNIAL----|                            3=Rooted Vascular
                |                 |                            4=Floating 
                |                 |                              Vascular
                |                 |                            5=Unknown 
                |                 |                              Submergent
                |--4=INTERMITTENT-|                            6=Unknown Surface
                |                 |
                |                 |- RS=Rocky Shore            1=Bedrock
                |                 |                            2=Rubble
                |                 |
                |                 |- US=Unconsolidated Shore   1=Cobble-Gravel
                |--5=UNKNOWN      |                            2=Sand
                |    PERENNIAL----|                            3=Mud
                   (used on older |                            4=Organic
                    maps)         |                            5=Vegetated
                                  |
                                  |-**EM=Emergent              2=Nonpersistent
                                  |
                                  |- OW=Open Water/Unknown Bottom (used on older
                                  |                                maps)
                                  |-*STREAMBED is limited to TIDAL and
                                  | INTERMITTENT SUBSYSTEMS, and comprises 
                                  | the only CLASS in the INTERMITTENT SUBSYSTEM.
                                  |
                                  |-**EMERGENT is limited to TIDAL and LOWER
                                  | PERENNIAL SUBSYSTEMS.




SYSTEM              SUBSYSTEM        CLASS                     SUBCLASS

                                  |- RB=Rock Bottom            1=Bedrock
                                  |                            2=Rubble
                                  |
                                  |- UB=Unconsolidated Bottom  1=Cobble-Gravel
                                  |                            2=Sand
                                  |                            3=Mud
                                  |                            4=Organic
                                  |
                |-- 1=LIMNETIC----|- AB=Aquatic Bed            1=Algal
                |                 |                            2=Aquatic Moss
                |                 |                            3=Rooted Vascular
                |                 |                            4=Floating 
                |                 |                              Vascular
                |                 |                            5=Unknown 
                |                 |                              Submergent
                |                 |                            6=Unknown Surface
                |                 |
                |                 |- OW=Open Water/Unknown Bottom (used on older
                |                                                  maps)
L=LACUSTRINE----|
                |
                |
                |                 |- RB=Rock Bottom            1=Bedrock
                |                 |                            2=Rubble
                |                 |
                |                 |- UB=Unconsolidated Bottom  1=Cobble-Gravel
                |                 |                            2=Sand
                |                 |                            3=Mud
                |                 |                            4=Organic
                |                 |
                |                 |- AB=Aquatic Bed            1=Algal
                |                 |                            2=Aquatic Moss
                |                 |                            3=Rooted Vascular
                |                 |                            4=Floating
                |-- 2=LITTORAL----|                              Vascular
                                  |                            5=Unknown
                                  |                              Submergent
                                  |                            6=Unknown Surface
                                  |
                                  |- RS=Rocky Shore            1=Bedrock
                                  |                            2=Rubble
                                  |
                                  |- US=Unconsolidated Shore   1=Cobble-Gravel
                                  |                            2=Sand
                                  |                            3=Mud
                                  |                            4=Organic
                                  |                            5=Vegetated
                                  |
                                  |- EM=Emergent               2=Nonpersistent
                                  |
                                  |- OW=Open Water/Unknown Bottom (used on older
                                                                   maps)



SYSTEM              SUBSYSTEM        CLASS                     SUBCLASS

                                  |- RB=Rock Bottom            1=Bedrock
                                  |                            2=Rubble
                                  |
                                  |- UB=Unconsolidated Bottom  1=Cobble-Gravel
                                  |                            2=Sand
                                  |                            3=Mud
                                  |                            4=Organic
                                  |
                                  |- AB=Aquatic Bed            1=Algal
                                  |                            2=Aquatic Moss 
                                  |                            3=Rooted Vascular
                                  |                            4=Floating
                                  |                              Vascular
                                  |                            5=Unknown 
                                  |                              Submergent
                                  |                            6=Unknown Surface
                                  |
                                  |- US=Unconsolidated Shore   1=Cobble-Gravel
                                  |                            2=Sand
                                  |                            3=Mud
                                  |                            4=Organic
                                  |                            5=Vegetated
                                  |
                                  |- ML=Moss-Lichen            1=Moss
                                  |                            2=Lichen
                                  |
P=PALUSTRINE----------------------|- EM=Emergent               1=Persistent
                                  |                            2=Nonpersistent
                                  |
                                  |- SS=Scrub-Shrub            1=Broad-Leaved
                                  |                              Deciduous
                                  |                            2=Needle-Leaved
                                  |                              Deciduous
                                  |                            3=Broad-Leaved 
                                  |                              Evergreen
                                  |                            4=Needle-Leaved
                                  |                              Evergreen
                                  |                            5=Dead
                                  |                            6=Indeterminate
                                  |                              Deciduous
                                  |                            7=Indeterminate
                                  |                              Evergreen
                                  |
                                  |- FO=Forested               1=Broad-Leaved
                                  |                              Deciduous
                                  |                            2=Needle-Leaved
                                  |                              Deciduous
                                  |                            3=Broad-Leaved
                                  |                              Evergreen
                                  |                            4=Needle-Leaved
                                  |                              Evergreen
                                  |                            5=Dead
                                  |                            6=Indeterminate
                                  |                              Deciduous
                                  |                            7=Indeterminate
                                  |                              Evergreen
                                  |
                                  |- OW=Open Water/Unknown Bottom (used on older
                                                                   maps)



                                   MODIFIERS

                                  |- A=Temporarily Flooded
                                  |- B=Saturated                      
                                  |- C=Seasonally Flooded
                                  |- D=Seasonally Flooded/Well Drained
                                  |- E=Seasonally Flooded/Saturated 
                                  |- F=Semipermanently Flooded
                |--Non-Tidal------|- G=Intermittently Exposed
                |                 |- H=Permanently Flooded
                |                 |- J=Intermittently Flooded
                |                 |- K=Artificially Flooded 
                |                 |- W=Intermittently Flooded/Temporary (used on
                |                 |                                    older maps) 
                |                 |- Y=Saturated/Semipermanent/Seasonal (used on
                |                 |                                    older maps)
                |                 |- Z=Intermittently Exposed/Permanent (used on
                |                 |                                    older maps)
WATER REGIME----|                 |- U=Unknown
                |                 
                |                  
                |                    
                |                 
                |                 |- K=Artificially Flooded
                |                 |- L=Subtidal   
                |                 |- M=Irregularly Exposed  
                |                 |- N=Regularly Flooded 
                |--Tidal----------|- P=Irregularly Flooded
                                  |-*S=Temporary-Tidal   
                                  |-*R=Seasonal-Tidal
                                  |-*T=Semipermanent-Tidal
                                  |-*V=Permanent-Tidal
                                  |- U=Unknown
                                  | 
                                  |-*These water regimes are only used in 
                                  |  tidally influenced, freshwater systems.

                                  

                                  |- 1=Hyperhaline
                                  |- 2=Euhaline
                |--Coastal        |- 3=Mixohaline (Brackish)
                |  Halinity-------|- 4-Polyhaline
                |                 |- 5=Mesohaline
                |                 |- 6=Oligohaline
                |                 |- 0=Fresh
                |
                |
                |
WATER CHEMISTRY-|
                |                 |- 7=Hypersaline
                |--Inland         |- 8=Eusaline
                |  Salinity-------|- 9=Mixosaline
                |                 |- 0=Fresh
                |
                | 
                |
                |
                |--pH Modifiers   |- a=Acid
                   for all        |- t=Circumneutral
                   Fresh Water----|- i=Alkaline




SOIL------------------------------|- g=Organic
                                  |- n=Mineral




                                  |- b=Beaver
                                  |- d=Partially Drained/Ditched
SPECIAL MODIFIERS-----------------|- f=Farmed
                                  |- h=Diked/Impounded
                                  |- r=Artificial Substrate
                                  |- s=Spoil
                                  |- x=Excavated

U = Uplands
(Source: US FWS)

 See also the USFWS Wetland MApper Interactive Website & http://www.fws.gov/data/datafws.html

Last Updated ( 10 May 2004 )
 
< Prev   Next >

Submit Your GIS/Geo News/PR

blog comments powered by Disqus
Geo EDU Tip
EDU Webinars - 10 Awesome GeoTech Webinar Resources
SUGGESTED BOOK - Getting to Know ArcGIS for Desktop
HOT Devices
Video - Trimble Positions and the Geo Explorer 6000 XH
Social Media Tips
10 Map Services Your Business MUST Be Listed in
500 Social Media Marketing Tips: Essential Advice, Hints and Strategy for Business: Facebook, Twitter, Pinterest, Google+, YouTube, Instagram, LinkedIn, and More!
 
Featured Events

 List Your Event Here 

THE GISuser Newsletter

See Recent edition
newsletter

subscribe GISuser

We won't share your address!
Sponsor

Popular Stuff!
Features


NASA Continues 40-Year Legacy



GISuser Site Sponsor


Most Popular
GISuser HOT Spots!

Google Mashup Zone
GISuser WebMaps
Free Data Articles
Spotlights & Tips
GISuser Resumes
Data Links
10 Cool Things
The LBS Zone!

Partner Sites


lbszone.com


symbianone

geojobs Geo jobs

A Spatial Media LLC property




Spatial Media, LLC ©2003 - 2013 All rights reserved / Privacy Statement