About | Contact | Register | Advertise | FAQ
Free GISuser Newsletter
HomeNewsArticlesDataJobsEDUCommunityGalleryForumsLBSzoneSTOREBlogFlickr
Software | Spotlights on Geospatial Data | GIS Education / Events | Hardware | Mobile | Web Services | Earth Imagery  
advertisement

GISuser Newsletter

GIS & LBS News - 3X A Week
View recent edition

newsletter
 
Get the popular GISuser Today Newsletter SUBSCRIBE HERE
Register as a GISuser!

RSS Get GISuser via RSS


GISuser Sponsor


Featured Contest

 Participate in LizardTech's Contest at ESRI and Win a GPS!!

GISuser Sponsor


Recent Site Additions
Trimble Introduces Blue Ox Integrated Transportation Management System for Forestry
SiRF Sets Date for Second Annual Location 2.0 Summit
Freeway 2008 Drive Time Analysis Software Now Available from Spatial Insights
Next Generation Geoscape Intelligence System
Alacritech Boosts GIS Mapping Performance
TerraGo Technologies Achieves Record Growth in First Half of 2008
FREE DOWNLOAD: Introducing Team-GIS Explorer
Rockin’ Remote Sensing: Aerotec Provides 3D LIDAR Models for Ground-Breaking Music Video
ThinkGeo Releases Map Suite 3.0 Services Edition Beta 1
Weather Underground Launches New Online Hurricane Tracker WunderMap tracks Tropical Storm Dolly
Avenza Supports Springer Cartographics Cartography Design Compilation


GISuser Events
July 2008
MTWTFSS
30
1
2
3

GISuser Sponsor


GISuser Web 2.0

GISuser Sponsor


Home arrow Articles arrow Data arrow GISuser Guide to downloading Free NWI and USFWS data products     

GISuser HOT JOBS!
MORE COOL STUFF! GISuser Today , the Flickr & the AnyGeo Blog, Map Gallery

GISuser Guide to downloading Free NWI and USFWS data products   PDF  Print  E-mail
Written by Glenn Letham  
Thursday, 26 February 2004
The US Fish and Wildlife service makes a number of digital spatial data products available to the public for free download. The data sets accessible for each State are for larger scale data (1:24:000 up to 1:500,000). Most of these datasets are provided as ArcView SHP or E00 coverages.

By clicking on a State, you will then be presented with a number of available dataporducts including; data created by or maintained by the U.S. Fish and Wildlife Service as well as links to the metadata and data where possible. Data from other agencies is shown provided. NWI data downloads are provided in Arc/Info export or DLG formats and arranged by 1:250,000 quads.

To access and download 1:100K USGS DLG data, please select a State on the map below.

WAORIDMTNDMNCANVUTAZWYCONMSDIANEKSWIMIILMOOKTXARLAINOHKYTNMSALGAFLSCNCVADCWVPAMDDENJRIMACTVTMENHNYVIPRHIAK

Note: The image used to create this map was provided by the .

For a diagram that easily explains the NWI map codes, please see the reference diagrom provided below.


                    WETLANDS AND DEEPWATER HABITATS CLASSIFICATION


SYSTEM              SUBSYSTEM        CLASS                     SUBCLASS

                                  |- RB=Rock Bottom            1=Bedrock
                                  |                            2=Rubble
                                  |
                                  |- UB=Unconsolidated Bottom  1=Cobble-Gravel
                                  |                            2=Sand
                                  |                            3=Mud
                                  |                            4=Organic
                                  |
                |-- 1=SUBTIDAL----|- AB=Aquatic Bed            1=Algal
                |                 |                            3=Rooted Vascular
                |                 |                            5=Unknown 
                |                 |                              Submergent
                |                 |
                |                 |- RF=Reef                   1=Coral
                |                 |                            3=Worm
                |                 |
                |                 |- OW=Open Water/Unknown Bottom (used on older
                |                                                  maps)
M=MARINE--------|
                |
                |
                |                 |- AB=Aquatic Bed            1=Algal
                |                 |                            3=Rooted Vascular
                |                 |                            5=Unknown 
                |                 |                              Submergent
                |                 |
                |                 |- RF=Reef                   1=Coral
                |-- 2=INTERTIDAL--|                            3=Worm
                                  |
                                  |- RS=Rocky Shore            1=Bedrock
                                  |                            2=Rubble
                                  |
                                  |- US=Unconsolidated Shore   1=Cobble-Gravel
                                                               2=Sand
                                                               3=Mud
                                                               4=Organic

 

SYSTEM              SUBSYSTEM        CLASS                     SUBCLASS

                                  |- RB=Rock Bottom            1=Bedrock
                                  |                            2=Rubble
                                  |
                                  |- UB=Unconsolidated Bottom  1=Cobble-Gravel
                                  |                            2=Sand
                                  |                            3=Mud
                                  |                            4=Organic
                                  |
                |-- 1=SUBTIDAL----|- AB=Aquatic Bed            1=Algal
                |                 |                            3=Rooted Vascular
                |                 |                            4=Floating 
                |                 |                              Vascular
                |                 |                            5=Unknown 
                |                 |                              Submergent
                |                 |                            6=Unknown Surface
                |                 |
                |                 |- RF=Reef                   2=Mollusc
                |                 |                            3=Worm
                |                 |
                |                 |- OW=Open Water/Unknown Bottom (used on older
                |                                                  maps)
E=ESTUARINE-----|
                |                  
                |
                |                 |- AB=Aquatic Bed            1=Algal
                |                 |                            3=Rooted Vascular
                |                 |                            4=Floating 
                |                 |                              Vascular
                |                 |                            5=Unknown 
                |                 |                              Submergent
                |                 |                            6=Unknown Surface
                |                 |
                |                 |- RF=Reef                   2=Mollusc
                |                 |                            3=Worm
                |                 |
                |                 |- SB=Streambed              3=Cobble-Gravel
                |                 |                            4=Sand
                |                 |                            5=Mud
                |                 |                            6=Organic
                |                 |
                |                 |- RS=Rocky Shore            1=Bedrock
                |                 |                            2=Rubble
                |                 |
                |-- 2=INTERTIDAL--|- US=Unconsolidated Shore   1=Cobble-Gravel
                                  |                            2=Sand
                                  |                            3=Mud
                                  |                            4=Organic
                                  |
                                  |- EM=Emergent               1=Persistent
                                  |                            2=Nonpersistent
                                  |
                                  |- SS=Scrub-Shrub            1=Broad-Leaved
                                  |                              Deciduous
                                  |                            2=Needle-Leaved
                                  |                              Deciduous
                                  |                            3=Broad-Leaved 
                                  |                              Evergreen
                                  |                            4=Needle-Leaved
                                  |                              Evergreen
                                  |                            5=Dead
                                  |                            6=Indeterminate
                                  |                              Deciduous
                                  |                            7=Indeterminate
                                  |                              Evergreen
                                  |
                                  |- FO=Forested               1=Broad-Leaved
                                                                 Deciduous
                                                               2=Needle-Leaved
                                                                 Deciduous
                                                               3=Broad-Leaved
                                                                 Evergreen
                                                               4=Needle-Leaved
                                                                 Evergreen
                                                               5=Dead
                                                               6=Indeterminate
                                                                 Deciduous
                                                               7=Indeterminate
                                                                 Evergreen



 
SYSTEM              SUBSYSTEM        CLASS                     SUBCLASS

                                  |- RB=Rock Bottom            1=Bedrock
                                  |                            2=Rubble
                                  |
                                  |- UB=Unconsolidated Bottom  1=Cobble-Gravel
                                  |                            2=Sand
                |--1=TIDAL--------|                            3=Mud
                |                 |                            4=Organic
                |                 |
                |                 |-*SB=Streambed              1=Bedrock
                |                 |                            2=Rubble
                |                 |                            3=Cobble-Gravel
                |--2=LOWER        |                            4=Sand
                |    PERENNIAL----|                            5=Mud
                |                 |                            6=Organic
                |                 |                            7=Vegetated
                |                 |
                |                 |- AB=Aquatic Bed            1=Algal
R=RIVERINE------|--3=UPPER        |                            2=Aquatic Moss
                |    PERENNIAL----|                            3=Rooted Vascular
                |                 |                            4=Floating 
                |                 |                              Vascular
                |                 |                            5=Unknown 
                |                 |                              Submergent
                |--4=INTERMITTENT-|                            6=Unknown Surface
                |                 |
                |                 |- RS=Rocky Shore            1=Bedrock
                |                 |                            2=Rubble
                |                 |
                |                 |- US=Unconsolidated Shore   1=Cobble-Gravel
                |--5=UNKNOWN      |                            2=Sand
                |    PERENNIAL----|                            3=Mud
                   (used on older |                            4=Organic
                    maps)         |                            5=Vegetated
                                  |
                                  |-**EM=Emergent              2=Nonpersistent
                                  |
                                  |- OW=Open Water/Unknown Bottom (used on older
                                  |                                maps)
                                  |-*STREAMBED is limited to TIDAL and
                                  | INTERMITTENT SUBSYSTEMS, and comprises 
                                  | the only CLASS in the INTERMITTENT SUBSYSTEM.
                                  |
                                  |-**EMERGENT is limited to TIDAL and LOWER
                                  | PERENNIAL SUBSYSTEMS.




SYSTEM              SUBSYSTEM        CLASS                     SUBCLASS

                                  |- RB=Rock Bottom            1=Bedrock
                                  |                            2=Rubble
                                  |
                                  |- UB=Unconsolidated Bottom  1=Cobble-Gravel
                                  |                            2=Sand
                                  |                            3=Mud
                                  |                            4=Organic
                                  |
                |-- 1=LIMNETIC----|- AB=Aquatic Bed            1=Algal
                |                 |                            2=Aquatic Moss
                |                 |                            3=Rooted Vascular
                |                 |                            4=Floating 
                |                 |                              Vascular
                |                 |                            5=Unknown 
                |                 |                              Submergent
                |                 |                            6=Unknown Surface
                |                 |
                |                 |- OW=Open Water/Unknown Bottom (used on older
                |                                                  maps)
L=LACUSTRINE----|
                |
                |
                |                 |- RB=Rock Bottom            1=Bedrock
                |                 |                            2=Rubble
                |                 |
                |                 |- UB=Unconsolidated Bottom  1=Cobble-Gravel
                |                 |                            2=Sand
                |                 |                            3=Mud
                |                 |                            4=Organic
                |                 |
                |                 |- AB=Aquatic Bed            1=Algal
                |                 |                            2=Aquatic Moss
                |                 |                            3=Rooted Vascular
                |                 |                            4=Floating
                |-- 2=LITTORAL----|                              Vascular
                                  |                            5=Unknown
                                  |                              Submergent
                                  |                            6=Unknown Surface
                                  |
                                  |- RS=Rocky Shore            1=Bedrock
                                  |                            2=Rubble
                                  |
                                  |- US=Unconsolidated Shore   1=Cobble-Gravel
                                  |                            2=Sand
                                  |                            3=Mud
                                  |                            4=Organic
                                  |                            5=Vegetated
                                  |
                                  |- EM=Emergent               2=Nonpersistent
                                  |
                                  |- OW=Open Water/Unknown Bottom (used on older
                                                                   maps)



SYSTEM              SUBSYSTEM        CLASS                     SUBCLASS

                                  |- RB=Rock Bottom            1=Bedrock
                                  |                            2=Rubble
                                  |
                                  |- UB=Unconsolidated Bottom  1=Cobble-Gravel
                                  |                            2=Sand
                                  |                            3=Mud
                                  |                            4=Organic
                                  |
                                  |- AB=Aquatic Bed            1=Algal
                                  |                            2=Aquatic Moss 
                                  |                            3=Rooted Vascular
                                  |                            4=Floating
                                  |                              Vascular
                                  |                            5=Unknown 
                                  |                              Submergent
                                  |                            6=Unknown Surface
                                  |
                                  |- US=Unconsolidated Shore   1=Cobble-Gravel
                                  |                            2=Sand
                                  |                            3=Mud
                                  |                            4=Organic
                                  |                            5=Vegetated
                                  |
                                  |- ML=Moss-Lichen            1=Moss
                                  |                            2=Lichen
                                  |
P=PALUSTRINE----------------------|- EM=Emergent               1=Persistent
                                  |                            2=Nonpersistent
                                  |
                                  |- SS=Scrub-Shrub            1=Broad-Leaved
                                  |                              Deciduous
                                  |                            2=Needle-Leaved
                                  |                              Deciduous
                                  |                            3=Broad-Leaved 
                                  |                              Evergreen
                                  |                            4=Needle-Leaved
                                  |                              Evergreen
                                  |                            5=Dead
                                  |                            6=Indeterminate
                                  |                              Deciduous
                                  |                            7=Indeterminate
                                  |                              Evergreen
                                  |
                                  |- FO=Forested               1=Broad-Leaved
                                  |                              Deciduous
                                  |                            2=Needle-Leaved
                                  |                              Deciduous
                                  |                            3=Broad-Leaved
                                  |                              Evergreen
                                  |                            4=Needle-Leaved
                                  |                              Evergreen
                                  |                            5=Dead
                                  |                            6=Indeterminate
                                  |                              Deciduous
                                  |                            7=Indeterminate
                                  |                              Evergreen
                                  |
                                  |- OW=Open Water/Unknown Bottom (used on older
                                                                   maps)



                                   MODIFIERS

                                  |- A=Temporarily Flooded
                                  |- B=Saturated                      
                                  |- C=Seasonally Flooded
                                  |- D=Seasonally Flooded/Well Drained
                                  |- E=Seasonally Flooded/Saturated 
                                  |- F=Semipermanently Flooded
                |--Non-Tidal------|- G=Intermittently Exposed
                |                 |- H=Permanently Flooded
                |                 |- J=Intermittently Flooded
                |                 |- K=Artificially Flooded 
                |                 |- W=Intermittently Flooded/Temporary (used on
                |                 |                                    older maps) 
                |                 |- Y=Saturated/Semipermanent/Seasonal (used on
                |                 |                                    older maps)
                |                 |- Z=Intermittently Exposed/Permanent (used on
                |                 |                                    older maps)
WATER REGIME----|                 |- U=Unknown
                |                 
                |                  
                |                    
                |                 
                |                 |- K=Artificially Flooded
                |                 |- L=Subtidal   
                |                 |- M=Irregularly Exposed  
                |                 |- N=Regularly Flooded 
                |--Tidal----------|- P=Irregularly Flooded
                                  |-*S=Temporary-Tidal   
                                  |-*R=Seasonal-Tidal
                                  |-*T=Semipermanent-Tidal
                                  |-*V=Permanent-Tidal
                                  |- U=Unknown
                                  | 
                                  |-*These water regimes are only used in 
                                  |  tidally influenced, freshwater systems.

                                  

                                  |- 1=Hyperhaline
                                  |- 2=Euhaline
                |--Coastal        |- 3=Mixohaline (Brackish)
                |  Halinity-------|- 4-Polyhaline
                |                 |- 5=Mesohaline
                |                 |- 6=Oligohaline
                |                 |- 0=Fresh
                |
                |
                |
WATER CHEMISTRY-|
                |                 |- 7=Hypersaline
                |--Inland         |- 8=Eusaline
                |  Salinity-------|- 9=Mixosaline
                |                 |- 0=Fresh
                |
                | 
                |
                |
                |--pH Modifiers   |- a=Acid
                   for all        |- t=Circumneutral
                   Fresh Water----|- i=Alkaline




SOIL------------------------------|- g=Organic
                                  |- n=Mineral




                                  |- b=Beaver
                                  |- d=Partially Drained/Ditched
SPECIAL MODIFIERS-----------------|- f=Farmed
                                  |- h=Diked/Impounded
                                  |- r=Artificial Substrate
                                  |- s=Spoil
                                  |- x=Excavated

U = Uplands
(Source: US FWS)

 See also the USFWS Wetland MApper Interactive Website & http://www.fws.gov/data/datafws.html

 

Number of comments (0) - Add your comments to this article...


Digg!

Share This Item 

del.icio.us / Furl / digg this item!Digg / Slashdot / Y!MyWeb / reddit / newsvine  addtoany
Share on Facebook

Get the GISuser Today Newsletter (3X a week!)
 


The Editor's Blog


Glenn's AnyGeo BlogSee more threads and details about Glenn's AnyGeo Weblog HERE The Editor (Glenn) started the AnyGeo blog some time ago and the threads are now also mirrored here at GISuser.com - RSS feed is available to add to your favorite news reader.

Featured Events
  • 2008 ESRI International User Conference (ESRI UC) - Users from more than 120 countries come to learn new skills, share information, and discover best practices, tips, and tricks that they can use instantly. Be part of this extraordinary experience August 4–8, 2008, in San Diego, California.
  • 2008 ESRI Survey & Engineering GIS Summit - August 2-5, San Diego, California. Join more than 400 surveyors and engineers in exploring the possibilities of GIS technology. See how GIS software integrates with surveying and engineering tools to provide more complete business solutions and field processes.
  • GITA 17th Annual GIS for Oil & Gas Conference and Exhibition, set for Sept. 21-24, 2008 - The conference is the only event of its kind, devoted exclusively to geospatial applications and technologies for all aspects of the oil and gas industry.
  • GeoInt 2008 - Join us for the 5-year anniversary of the GEOINT SYMPOSIUM October 27-30 in Nashville, Tenn., where you'll have an unparalleled opportunity to learn, network and discover as we discuss the importance of being Mission Focused while Transitioning to the Future.

List Your Event Here


Recent GISuser Discussions
1: LBS in South Africa by Paul
2: ArcGIS Desktop II/III v9.3, ID by Bruce Kessler
3: Arcpad Class by DebbyB
4: Geospatial Professional (3 Yrs Exp) by Shane Smith
5: Apple Iphone 16GB/ New Edition 3G by telcom

show last 4hrs - 24hrs

Google Geospatial Search
Google
 

 

or... try our CUSTOM GISuser Google Search!

Contribute to the GISuser Search (by Google)


Today's Top News


Sponsor




GISuser RSS Feed
Get the latest Geospatial news
direct to your desktop
RSS


feedburner
add to google reader




technocrati

See ALL the GISuser Feeds


GISuser Site Sponsor


Most Popular
Gmaps 101 - An Introduction to Google Maps & The Google Maps API (Part 1)
The GISuser's Guide to locating and downloading Free USGS data
Hackers Tap Into the Functionality and Simplicity of Google Maps
GISuser Guide to downloading Free 7.5 minute DEMs
Gmaps 101 - An Introduction to Google Maps & The Google Maps API V2 (Part 2)
BearingPoint, ESRI SAS Introduce Leading-Edge Development Planning Solution for Commercial Retailers
GIS Community Resources
State GIS Clearinghouse Directory - Update, July 2004
ShakeMap — A Tool for Earthquake Response
Maps and cartograms of 2004 US presidential election results

GISuser WebMaps

USGS Ortho-Imagery Viewer/Downloads

GISuser HOT Spots!

Google Mashup Zone
GISuser WebMaps
Free Data Articles
Spotlights & Tips
GISuser Resumes
Data Links
10 Cool Things
The LBS Zone!


Partner Sites

Geo Widgets

 


Affiliations


Get GISuser news & updates via RSS


Mobilize / Share

GIS / LBS Mosh
Add to my Widsets


Top Stops

GISuser Site Login
Username

Password
Forgotten your password?
No account yet? Create one




Spatial Media, LLC ©2003 - 2008 All rights reserved / Privacy Statement