About | Contact | SUBMIT PRESS | Advertise | FAQ
Spatial Newsletters | Twitter |
HomeNewsArticlesExpertsDataJobsEDULBSSTOREEVENTSDirectoryBLOGPHOTOSSocial Media
Software | Spotlights on Geospatial Data | Web Services | Mashup Zone | IMAGING | Hardware | Social Media  
advertisement

Top Geo News
Put Your News here! 
Social Connect




vimeostumble


Facebook

GISuser Sponsor


Recent Site Additions
Featured Webinar
Featured Video


GISuser TOP 10 Viewed Videos
More Photos and Videos

GIS Job Opportunities
 

Loads of GIS Jobs!

GIS Analyst
Data Processor
Software Developer
Support Analyst - Database
Applications Prototype Specialist–Web Development
Research Assistant for Geographic Information Centre
Academic Associate in Geographic Information Centre
Director of Mobile Product and Technology (Denver)
Subject Matter Expert — Infrastructure Industry - 12WD11118
GIS Analyst Senior
GISuser Sponsor

Directory
Limbo  
Category: Social Networking and Social Location Services


GISuser Sponsor


AnyGeo - Anything Geospatial

↑ Grab this Headline Animator

GISuser RSS Feed
Home arrow Articles arrow Data arrow GISuser Guide to downloading Free NWI and USFWS data products     

Feature - Using QR Codes to Deliver Maps Electronically
HOT JOB
post a GIS job * JOB OPPS * Subject Matter Expert, Autodesk CA / GIS Developer, VA
FEATURE - Using Social Media and Twitter To Land The Perfect Job
Submit Your GIS/Geo News/PR to GISuser
GISuser Guide to downloading Free NWI and USFWS data products  E-mail
Written by Glenn Letham   
26 February 2004
The US Fish and Wildlife service makes a number of digital spatial data products available to the public for free download. The data sets accessible for each State are for larger scale data (1:24:000 up to 1:500,000). Most of these datasets are provided as ArcView SHP or E00 coverages.

By clicking on a State, you will then be presented with a number of available dataporducts including; data created by or maintained by the U.S. Fish and Wildlife Service as well as links to the metadata and data where possible. Data from other agencies is shown provided. NWI data downloads are provided in Arc/Info export or DLG formats and arranged by 1:250,000 quads.

To access and download 1:100K USGS DLG data, please select a State on the map below.

WAORIDMTNDMNCANVUTAZWYCONMSDIANEKSWIMIILMOOKTXARLAINOHKYTNMSALGAFLSCNCVADCWVPAMDDENJRIMACTVTMENHNYVIPRHIAK

Note: The image used to create this map was provided by the .

For a diagram that easily explains the NWI map codes, please see the reference diagrom provided below.


                    WETLANDS AND DEEPWATER HABITATS CLASSIFICATION


SYSTEM              SUBSYSTEM        CLASS                     SUBCLASS

                                  |- RB=Rock Bottom            1=Bedrock
                                  |                            2=Rubble
                                  |
                                  |- UB=Unconsolidated Bottom  1=Cobble-Gravel
                                  |                            2=Sand
                                  |                            3=Mud
                                  |                            4=Organic
                                  |
                |-- 1=SUBTIDAL----|- AB=Aquatic Bed            1=Algal
                |                 |                            3=Rooted Vascular
                |                 |                            5=Unknown 
                |                 |                              Submergent
                |                 |
                |                 |- RF=Reef                   1=Coral
                |                 |                            3=Worm
                |                 |
                |                 |- OW=Open Water/Unknown Bottom (used on older
                |                                                  maps)
M=MARINE--------|
                |
                |
                |                 |- AB=Aquatic Bed            1=Algal
                |                 |                            3=Rooted Vascular
                |                 |                            5=Unknown 
                |                 |                              Submergent
                |                 |
                |                 |- RF=Reef                   1=Coral
                |-- 2=INTERTIDAL--|                            3=Worm
                                  |
                                  |- RS=Rocky Shore            1=Bedrock
                                  |                            2=Rubble
                                  |
                                  |- US=Unconsolidated Shore   1=Cobble-Gravel
                                                               2=Sand
                                                               3=Mud
                                                               4=Organic

 

SYSTEM              SUBSYSTEM        CLASS                     SUBCLASS

                                  |- RB=Rock Bottom            1=Bedrock
                                  |                            2=Rubble
                                  |
                                  |- UB=Unconsolidated Bottom  1=Cobble-Gravel
                                  |                            2=Sand
                                  |                            3=Mud
                                  |                            4=Organic
                                  |
                |-- 1=SUBTIDAL----|- AB=Aquatic Bed            1=Algal
                |                 |                            3=Rooted Vascular
                |                 |                            4=Floating 
                |                 |                              Vascular
                |                 |                            5=Unknown 
                |                 |                              Submergent
                |                 |                            6=Unknown Surface
                |                 |
                |                 |- RF=Reef                   2=Mollusc
                |                 |                            3=Worm
                |                 |
                |                 |- OW=Open Water/Unknown Bottom (used on older
                |                                                  maps)
E=ESTUARINE-----|
                |                  
                |
                |                 |- AB=Aquatic Bed            1=Algal
                |                 |                            3=Rooted Vascular
                |                 |                            4=Floating 
                |                 |                              Vascular
                |                 |                            5=Unknown 
                |                 |                              Submergent
                |                 |                            6=Unknown Surface
                |                 |
                |                 |- RF=Reef                   2=Mollusc
                |                 |                            3=Worm
                |                 |
                |                 |- SB=Streambed              3=Cobble-Gravel
                |                 |                            4=Sand
                |                 |                            5=Mud
                |                 |                            6=Organic
                |                 |
                |                 |- RS=Rocky Shore            1=Bedrock
                |                 |                            2=Rubble
                |                 |
                |-- 2=INTERTIDAL--|- US=Unconsolidated Shore   1=Cobble-Gravel
                                  |                            2=Sand
                                  |                            3=Mud
                                  |                            4=Organic
                                  |
                                  |- EM=Emergent               1=Persistent
                                  |                            2=Nonpersistent
                                  |
                                  |- SS=Scrub-Shrub            1=Broad-Leaved
                                  |                              Deciduous
                                  |                            2=Needle-Leaved
                                  |                              Deciduous
                                  |                            3=Broad-Leaved 
                                  |                              Evergreen
                                  |                            4=Needle-Leaved
                                  |                              Evergreen
                                  |                            5=Dead
                                  |                            6=Indeterminate
                                  |                              Deciduous
                                  |                            7=Indeterminate
                                  |                              Evergreen
                                  |
                                  |- FO=Forested               1=Broad-Leaved
                                                                 Deciduous
                                                               2=Needle-Leaved
                                                                 Deciduous
                                                               3=Broad-Leaved
                                                                 Evergreen
                                                               4=Needle-Leaved
                                                                 Evergreen
                                                               5=Dead
                                                               6=Indeterminate
                                                                 Deciduous
                                                               7=Indeterminate
                                                                 Evergreen



 
SYSTEM              SUBSYSTEM        CLASS                     SUBCLASS

                                  |- RB=Rock Bottom            1=Bedrock
                                  |                            2=Rubble
                                  |
                                  |- UB=Unconsolidated Bottom  1=Cobble-Gravel
                                  |                            2=Sand
                |--1=TIDAL--------|                            3=Mud
                |                 |                            4=Organic
                |                 |
                |                 |-*SB=Streambed              1=Bedrock
                |                 |                            2=Rubble
                |                 |                            3=Cobble-Gravel
                |--2=LOWER        |                            4=Sand
                |    PERENNIAL----|                            5=Mud
                |                 |                            6=Organic
                |                 |                            7=Vegetated
                |                 |
                |                 |- AB=Aquatic Bed            1=Algal
R=RIVERINE------|--3=UPPER        |                            2=Aquatic Moss
                |    PERENNIAL----|                            3=Rooted Vascular
                |                 |                            4=Floating 
                |                 |                              Vascular
                |                 |                            5=Unknown 
                |                 |                              Submergent
                |--4=INTERMITTENT-|                            6=Unknown Surface
                |                 |
                |                 |- RS=Rocky Shore            1=Bedrock
                |                 |                            2=Rubble
                |                 |
                |                 |- US=Unconsolidated Shore   1=Cobble-Gravel
                |--5=UNKNOWN      |                            2=Sand
                |    PERENNIAL----|                            3=Mud
                   (used on older |                            4=Organic
                    maps)         |                            5=Vegetated
                                  |
                                  |-**EM=Emergent              2=Nonpersistent
                                  |
                                  |- OW=Open Water/Unknown Bottom (used on older
                                  |                                maps)
                                  |-*STREAMBED is limited to TIDAL and
                                  | INTERMITTENT SUBSYSTEMS, and comprises 
                                  | the only CLASS in the INTERMITTENT SUBSYSTEM.
                                  |
                                  |-**EMERGENT is limited to TIDAL and LOWER
                                  | PERENNIAL SUBSYSTEMS.




SYSTEM              SUBSYSTEM        CLASS                     SUBCLASS

                                  |- RB=Rock Bottom            1=Bedrock
                                  |                            2=Rubble
                                  |
                                  |- UB=Unconsolidated Bottom  1=Cobble-Gravel
                                  |                            2=Sand
                                  |                            3=Mud
                                  |                            4=Organic
                                  |
                |-- 1=LIMNETIC----|- AB=Aquatic Bed            1=Algal
                |                 |                            2=Aquatic Moss
                |                 |                            3=Rooted Vascular
                |                 |                            4=Floating 
                |                 |                              Vascular
                |                 |                            5=Unknown 
                |                 |                              Submergent
                |                 |                            6=Unknown Surface
                |                 |
                |                 |- OW=Open Water/Unknown Bottom (used on older
                |                                                  maps)
L=LACUSTRINE----|
                |
                |
                |                 |- RB=Rock Bottom            1=Bedrock
                |                 |                            2=Rubble
                |                 |
                |                 |- UB=Unconsolidated Bottom  1=Cobble-Gravel
                |                 |                            2=Sand
                |                 |                            3=Mud
                |                 |                            4=Organic
                |                 |
                |                 |- AB=Aquatic Bed            1=Algal
                |                 |                            2=Aquatic Moss
                |                 |                            3=Rooted Vascular
                |                 |                            4=Floating
                |-- 2=LITTORAL----|                              Vascular
                                  |                            5=Unknown
                                  |                              Submergent
                                  |                            6=Unknown Surface
                                  |
                                  |- RS=Rocky Shore            1=Bedrock
                                  |                            2=Rubble
                                  |
                                  |- US=Unconsolidated Shore   1=Cobble-Gravel
                                  |                            2=Sand
                                  |                            3=Mud
                                  |                            4=Organic
                                  |                            5=Vegetated
                                  |
                                  |- EM=Emergent               2=Nonpersistent
                                  |
                                  |- OW=Open Water/Unknown Bottom (used on older
                                                                   maps)



SYSTEM              SUBSYSTEM        CLASS                     SUBCLASS

                                  |- RB=Rock Bottom            1=Bedrock
                                  |                            2=Rubble
                                  |
                                  |- UB=Unconsolidated Bottom  1=Cobble-Gravel
                                  |                            2=Sand
                                  |                            3=Mud
                                  |                            4=Organic
                                  |
                                  |- AB=Aquatic Bed            1=Algal
                                  |                            2=Aquatic Moss 
                                  |                            3=Rooted Vascular
                                  |                            4=Floating
                                  |                              Vascular
                                  |                            5=Unknown 
                                  |                              Submergent
                                  |                            6=Unknown Surface
                                  |
                                  |- US=Unconsolidated Shore   1=Cobble-Gravel
                                  |                            2=Sand
                                  |                            3=Mud
                                  |                            4=Organic
                                  |                            5=Vegetated
                                  |
                                  |- ML=Moss-Lichen            1=Moss
                                  |                            2=Lichen
                                  |
P=PALUSTRINE----------------------|- EM=Emergent               1=Persistent
                                  |                            2=Nonpersistent
                                  |
                                  |- SS=Scrub-Shrub            1=Broad-Leaved
                                  |                              Deciduous
                                  |                            2=Needle-Leaved
                                  |                              Deciduous
                                  |                            3=Broad-Leaved 
                                  |                              Evergreen
                                  |                            4=Needle-Leaved
                                  |                              Evergreen
                                  |                            5=Dead
                                  |                            6=Indeterminate
                                  |                              Deciduous
                                  |                            7=Indeterminate
                                  |                              Evergreen
                                  |
                                  |- FO=Forested               1=Broad-Leaved
                                  |                              Deciduous
                                  |                            2=Needle-Leaved
                                  |                              Deciduous
                                  |                            3=Broad-Leaved
                                  |                              Evergreen
                                  |                            4=Needle-Leaved
                                  |                              Evergreen
                                  |                            5=Dead
                                  |                            6=Indeterminate
                                  |                              Deciduous
                                  |                            7=Indeterminate
                                  |                              Evergreen
                                  |
                                  |- OW=Open Water/Unknown Bottom (used on older
                                                                   maps)



                                   MODIFIERS

                                  |- A=Temporarily Flooded
                                  |- B=Saturated                      
                                  |- C=Seasonally Flooded
                                  |- D=Seasonally Flooded/Well Drained
                                  |- E=Seasonally Flooded/Saturated 
                                  |- F=Semipermanently Flooded
                |--Non-Tidal------|- G=Intermittently Exposed
                |                 |- H=Permanently Flooded
                |                 |- J=Intermittently Flooded
                |                 |- K=Artificially Flooded 
                |                 |- W=Intermittently Flooded/Temporary (used on
                |                 |                                    older maps) 
                |                 |- Y=Saturated/Semipermanent/Seasonal (used on
                |                 |                                    older maps)
                |                 |- Z=Intermittently Exposed/Permanent (used on
                |                 |                                    older maps)
WATER REGIME----|                 |- U=Unknown
                |                 
                |                  
                |                    
                |                 
                |                 |- K=Artificially Flooded
                |                 |- L=Subtidal   
                |                 |- M=Irregularly Exposed  
                |                 |- N=Regularly Flooded 
                |--Tidal----------|- P=Irregularly Flooded
                                  |-*S=Temporary-Tidal   
                                  |-*R=Seasonal-Tidal
                                  |-*T=Semipermanent-Tidal
                                  |-*V=Permanent-Tidal
                                  |- U=Unknown
                                  | 
                                  |-*These water regimes are only used in 
                                  |  tidally influenced, freshwater systems.

                                  

                                  |- 1=Hyperhaline
                                  |- 2=Euhaline
                |--Coastal        |- 3=Mixohaline (Brackish)
                |  Halinity-------|- 4-Polyhaline
                |                 |- 5=Mesohaline
                |                 |- 6=Oligohaline
                |                 |- 0=Fresh
                |
                |
                |
WATER CHEMISTRY-|
                |                 |- 7=Hypersaline
                |--Inland         |- 8=Eusaline
                |  Salinity-------|- 9=Mixosaline
                |                 |- 0=Fresh
                |
                | 
                |
                |
                |--pH Modifiers   |- a=Acid
                   for all        |- t=Circumneutral
                   Fresh Water----|- i=Alkaline




SOIL------------------------------|- g=Organic
                                  |- n=Mineral




                                  |- b=Beaver
                                  |- d=Partially Drained/Ditched
SPECIAL MODIFIERS-----------------|- f=Farmed
                                  |- h=Diked/Impounded
                                  |- r=Artificial Substrate
                                  |- s=Spoil
                                  |- x=Excavated

U = Uplands
(Source: US FWS)

 See also the USFWS Wetland MApper Interactive Website & http://www.fws.gov/data/datafws.html

Last Updated ( 10 May 2004 )
 
< Prev   Next >

Submit Your GIS/Geo News/PR to GISuser



Search the Spatial Media Web Resources
Developer Tip
PhoneGap - OpenSource Devlopment Framework; Deploy to 7 Major Mobile Platforms
 
HOT Devices
Introducing the RAMPAGE 6 Rugged Notepad with Android 
Social Media Tips
Using Social Media and Twitter To Land The Perfect Job - Tips, Tricks, Trends - Finding a job can be a daunting task but it doesn't have to be. Many are turning to social media, in particular Twitter, to help score a new gig.
 

deliciousrssnewsletterlinkedinfacebooktwitter

More GISuser Features

feature articlesSee more GISuser Features HERE / See GISuser Spotlights Here

AnyGeo - Geospatial Updates from Glenn

↑ Grab this Headline Animator

Recent Directory Listings
1. SAIC GeoRover Mobile
    Category: GIS for Tablets - iPad and Android Tablet Geo Solutions
    Created: May 22, 2012
2. Arvada Colorado OpenData
    Category: OpenGov and OpenData
    Created: May 21, 2012
3. Colorado OpenData
    Category: OpenGov and OpenData
    Created: May 21, 2012
4. Inlailawatash Forestry...
    Category: Geo Tech Companies & Consultants
    Created: May 15, 2012
5. CSU Fresno
    Category: Distance Learning, Online GIS Education
    Created: May 10, 2012
Show more...
Featured Events

 List Your Event Here 

2X A Week Newsletter

See Recent edition
newsletter

subscribe GISuser

We won't share your address!
Sponsor

Popular Stuff!


RSS and Feeds

Software

software reviews
Geo Technology Software

GISuser Site Sponsor


Most Popular
GISuser HOT Spots!

Google Mashup Zone
GISuser WebMaps
Free Data Articles
Spotlights & Tips
GISuser Resumes
Data Links
10 Cool Things
The LBS Zone!

Partner Sites


lbszone.com


symbianone

A Spatial Media LLC property

 




Spatial Media, LLC ©2003 - 2011 All rights reserved / Privacy Statement